Reference Tool
Compare Compounds
Place up to three reference compounds side by side to compare their molecular profile, pharmacokinetics, and handling.
| Attribute | kpv-msh-fragment | ghk-cu | ll-37 |
|---|---|---|---|
| Field of Medicine | Immunology · Inflammation Research | Dermatology · Wound-Healing Research | Immunology · Antimicrobial Research |
| Category | immune | cosmetic | immune |
| Formula | — | C14H24N6O4·Cu | — |
| Molecular Weight | — | 402.92 Da | — |
| Sequence | Lys-Pro-Val (C-terminal α-MSH fragment) | Gly-His-Lys + Cu(II) | 37-amino-acid cathelicidin ([LL-37, 37 aa]) |
| CAS Number | — | 49557-75-7 | — |
| Half-Life | — | — | — |
| Route (research) | Oral, topical, or subcutaneous in research | Topical, intradermal, or subcutaneous in research | — |
| Onset / Steady-state | — | — | — |
| Lyophilized Storage | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. |
| Reconstituted Storage | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. |