Reference Tool
Compare Compounds
Place up to three reference compounds side by side to compare their molecular profile, pharmacokinetics, and handling.
| Attribute | ll-37 | kpv-msh-fragment | retatrutide |
|---|---|---|---|
| Field of Medicine | Immunology · Antimicrobial Research | Immunology · Inflammation Research | Endocrinology · Metabolic Research |
| Category | immune | immune | incretin |
| Formula | — | — | — |
| Molecular Weight | — | — | ~4731 Da |
| Sequence | 37-amino-acid cathelicidin (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) | Lys-Pro-Val (C-terminal α-MSH fragment) | 39-amino-acid triple agonist (GLP-1 / GIP / glucagon) |
| CAS Number | — | — | — |
| Half-Life | — | — | ~6 days |
| Route (research) | — | Oral, topical, or subcutaneous in research | Subcutaneous in research models |
| Onset / Steady-state | — | — | — |
| Lyophilized Storage | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. |
| Reconstituted Storage | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. |