Park Ave Peptides — Clinical Reference Library — For Professional Use Only

Reference Tool

Compare Compounds

Place up to three reference compounds side by side to compare their molecular profile, pharmacokinetics, and handling.

Attributethymosin-alpha-1thymalin-thymic-peptidell-37
Field of MedicineImmunology · Host-Defense ResearchImmunology · Geroscience ResearchImmunology · Antimicrobial Research
Categoryimmuneimmuneimmune
FormulaC129H215N33O55
Molecular Weight3108.3 Da
Sequence28-amino-acid acetylated peptideThymic polypeptide complex37-amino-acid cathelicidin ([LL-37, 37 aa])
CAS Number62304-98-7
Half-Life~2 hours systemically
Route (research)
Onset / Steady-state
Lyophilized Storage−20°C long term; 2–8°C short term (weeks). Protect from light.−20°C long term; 2–8°C short term (weeks). Protect from light.−20°C long term; 2–8°C short term (weeks). Protect from light.
Reconstituted Storage2–8°C, generally up to 14–28 days depending on compound.2–8°C, generally up to 14–28 days depending on compound.2–8°C, generally up to 14–28 days depending on compound.