Reference Tool
Compare Compounds
Place up to three reference compounds side by side to compare their molecular profile, pharmacokinetics, and handling.
| Attribute | thymosin-alpha-1 | thymalin-thymic-peptide | ll-37 |
|---|---|---|---|
| Field of Medicine | Immunology · Host-Defense Research | Immunology · Geroscience Research | Immunology · Antimicrobial Research |
| Category | immune | immune | immune |
| Formula | C129H215N33O55 | — | — |
| Molecular Weight | 3108.3 Da | — | — |
| Sequence | 28-amino-acid acetylated peptide | Thymic polypeptide complex | 37-amino-acid cathelicidin ([LL-37, 37 aa]) |
| CAS Number | 62304-98-7 | — | — |
| Half-Life | ~2 hours systemically | — | — |
| Route (research) | — | — | — |
| Onset / Steady-state | — | — | — |
| Lyophilized Storage | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. | −20°C long term; 2–8°C short term (weeks). Protect from light. |
| Reconstituted Storage | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. | 2–8°C, generally up to 14–28 days depending on compound. |